PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G2045
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 339aa    MW: 38274.3 Da    PI: 9.6366
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G2045genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181863147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G  +W++Ia++++ gR++k+c++rw++ 
      Gh_A05G2045 18 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 63
                     899*****************************.***********996 PP

2Myb_DNA-binding61.32e-1970113146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
      Gh_A05G2045  70 RRPFTEEEEERLLAAHHIHGNK-WALIARLFP-GRTDNAVKNHWHV 113
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.9971364IPR017930Myb domain
SMARTSM007178.4E-151766IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-2917111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-271971IPR009057Homeodomain-like
PfamPF139212.5E-172181No hitNo description
CDDcd001674.28E-142162No hitNo description
PROSITE profilePS5129428.09865119IPR017930Myb domain
SMARTSM007171.9E-1669117IPR001005SANT/Myb domain
CDDcd001676.53E-872112No hitNo description
Gene3DG3DSA:1.10.10.609.3E-2272118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEDSGAASSD DVNKTCPRGH WRPAEDEKLR QLVEQYGAQN WNSIAEKLQG RSGKSCRLRW  60
FNQLDPRINR RPFTEEEEER LLAAHHIHGN KWALIARLFP GRTDNAVKNH WHVIMARKQR  120
EQSKLCGKRS FQDAFSDSKL SSTGFSTSRK LARCQEAFSS RFGFGDSRFF DQFQNQGKDK  180
IFSVSSTSTT SSPSWNFASS TMVASNNSSS AQLSIRDGKN HLLRSGSSYY SMDTSKLLDQ  240
SLYKYHSNAS AYCSSFRNSS AFGIHNYRRV VPSPFGYLKL GDNFESNNGV MTKEFLSITD  300
NAPKSANLRV SNSQQEQEDE SDKTKDVPFI DFLGVGISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32181187107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5270821e-100HQ527082.1 Gossypium herbaceum clone NBRI_B_1735 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448228.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0B0NFX40.0A0A0B0NFX4_G
STRINGPOPTR_0005s20870.11e-140(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16592913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-63myb domain protein 52